Lineage for d3lndb2 (3lnd B:100-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763600Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. 2763636Domain d3lndb2: 3lnd B:100-207 [212953]
    automated match to d1ncja2
    complexed with ca

Details for d3lndb2

PDB Entry: 3lnd (more details), 2.82 Å

PDB Description: crystal structure of cadherin-6 ec12 w4a
PDB Compounds: (B:) Cdh6 protein

SCOPe Domain Sequences for d3lndb2:

Sequence, based on SEQRES records: (download)

>d3lndb2 b.1.6.0 (B:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnmdrenreqyqvviqakdmggqmgglsgtttvnitltd

Sequence, based on observed residues (ATOM records): (download)

>d3lndb2 b.1.6.0 (B:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnreqyqvviqakdmggqmgglsgtttvnitltd

SCOPe Domain Coordinates for d3lndb2:

Click to download the PDB-style file with coordinates for d3lndb2.
(The format of our PDB-style files is described here.)

Timeline for d3lndb2: