| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries) |
| Domain d3lnda1: 3lnd A:5-99 [212950] automated match to d1ncja1 complexed with ca |
PDB Entry: 3lnd (more details), 2.82 Å
SCOPe Domain Sequences for d3lnda1:
Sequence, based on SEQRES records: (download)
>d3lnda1 b.1.6.0 (A:5-99) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqatkrld
reekpvyilraqavnrrtgrpvepesefiikihdi
>d3lnda1 b.1.6.0 (A:5-99) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqatkrld
reekpvyilvnrrtgrpvepesefiikihdi
Timeline for d3lnda1: