Lineage for d3lmya2 (3lmy A:200-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083957Species Human (Homo sapiens) [TaxId:9606] [226772] (2 PDB entries)
  8. 2083962Domain d3lmya2: 3lmy A:200-552 [212945]
    Other proteins in same PDB: d3lmya1, d3lmyb1
    automated match to d2gjxa1
    complexed with cp6, nag, ndg, so4

Details for d3lmya2

PDB Entry: 3lmy (more details), 2.8 Å

PDB Description: The Crystal Structure of beta-hexosaminidase B in complex with Pyrimethamine
PDB Compounds: (A:) Beta-hexosaminidase subunit beta

SCOPe Domain Sequences for d3lmya2:

Sequence, based on SEQRES records: (download)

>d3lmya2 c.1.8.0 (A:200-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Sequence, based on observed residues (ATOM records): (download)

>d3lmya2 c.1.8.0 (A:200-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysdsfgpinp
tlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkkle
sfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpvi
lsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlwp
rasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d3lmya2:

Click to download the PDB-style file with coordinates for d3lmya2.
(The format of our PDB-style files is described here.)

Timeline for d3lmya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lmya1