Lineage for d3lmya1 (3lmy A:54-199)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965198Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2965199Protein automated matches [227062] (5 species)
    not a true protein
  7. 2965217Species Human (Homo sapiens) [TaxId:9606] [226074] (2 PDB entries)
  8. 2965219Domain d3lmya1: 3lmy A:54-199 [212944]
    Other proteins in same PDB: d3lmya2, d3lmyb2
    automated match to d2gjxa2
    complexed with cp6, nag, ndg, so4

Details for d3lmya1

PDB Entry: 3lmy (more details), 2.8 Å

PDB Description: the crystal structure of beta-hexosaminidase b in complex with pyrimethamine
PDB Compounds: (A:) Beta-hexosaminidase subunit beta

SCOPe Domain Sequences for d3lmya1:

Sequence, based on SEQRES records: (download)

>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyiftqvqqll
vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
inestiidspr

SCOPe Domain Coordinates for d3lmya1:

Click to download the PDB-style file with coordinates for d3lmya1.
(The format of our PDB-style files is described here.)

Timeline for d3lmya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lmya2