![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
![]() | Protein automated matches [227062] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226074] (2 PDB entries) |
![]() | Domain d3lmya1: 3lmy A:54-199 [212944] Other proteins in same PDB: d3lmya2, d3lmyb2 automated match to d2gjxa2 complexed with cp6, nag, ndg, so4 |
PDB Entry: 3lmy (more details), 2.8 Å
SCOPe Domain Sequences for d3lmya1:
Sequence, based on SEQRES records: (download)
>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle tfsqlvyqdsygtftinestiidspr
>d3lmya1 d.92.2.0 (A:54-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyiftqvqqll vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft inestiidspr
Timeline for d3lmya1: