SCOP 1.63: Domain d1a5fl2: 1a5f L:114-220

Lineage for d1a5fl2 (1a5f L:114-220)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-E-selectin Fab (mouse), kappa L chain [49074] (1 PDB entry)

8. Domain d1a5fl2: 1a5f L:114-220 [21294]
   Other proteins in same PDB: d1a5fh1, d1a5fl1

Details for d1a5fl2

PDB Entry: 1a5f, 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

SCOP Domain Sequences for d1a5fl2:

Sequence; same for both SEQRES and ATOM records:

>d1a5fl2 b.1.1.2 (L:114-220) Immunoglobulin (constant domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1a5fl2:

• d1a5fl2 first appeared (with stable ids) in SCOP 1.55
  
• d1a5fl2 appears in SCOP 1.61
  
• d1a5fl2 appears in SCOP 1.65
  
• d1a5fl2 appears in the current release, SCOPe 2.08