Lineage for d1a5fl2 (1a5f L:114-220)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220911Species Anti-E-selectin Fab (mouse), kappa L chain [49074] (1 PDB entry)
  8. 220913Domain d1a5fl2: 1a5f L:114-220 [21294]
    Other proteins in same PDB: d1a5fh1, d1a5fl1

Details for d1a5fl2

PDB Entry: 1a5f (more details), 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

SCOP Domain Sequences for d1a5fl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5fl2 b.1.1.2 (L:114-220) Immunoglobulin (constant domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1a5fl2:

Click to download the PDB-style file with coordinates for d1a5fl2.
(The format of our PDB-style files is described here.)

Timeline for d1a5fl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5fl1