SCOPe 2.03: Domain d3lmtb_: 3lmt B:

Lineage for d3lmtb_ (3lmt B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (2 families)
   active form is a dimer

5. Family c.110.1.0: automated matches [191422] (1 protein)
   not a true family

6. Protein automated matches [190596] (2 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [196467] (11 PDB entries)

8. Domain d3lmtb_: 3lmt B: [212939]
   automated match to d3lmvf_
   complexed with iod

Details for d3lmtb_

PDB Entry: 3lmt, 2.75 Å

PDB Description: crystal structure of dtd from plasmodium falciparum

PDB Compounds: (B:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d3lmtb_:

Sequence, based on SEQRES records:

>d3lmtb_ c.110.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvrkenigenekeleiiseiknglicflgihkndtwedalyiirkcl
nlrlwnndnktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkii
defkkqynddkikigkfgnymnidvtndgpvtiyidthdin

Sequence, based on observed residues (ATOM records):

>d3lmtb_ c.110.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mrvviqrvkgailsvreleiiseiknglicflgihkndtwedalyiirkclnlrlwnndn
ktwdknvkdlnyellivsqftlfgntkkgnkpdfhlakepnealifynkiidefkkqynd
dkikigkfgnymnidvtndgpvtiyidthdin

Timeline for d3lmtb_:

• d3lmtb_ is new in SCOPe 2.03-stable
  
• d3lmtb_ appears in SCOPe 2.04
  
• d3lmtb_ appears in the current release, SCOPe 2.08