SCOPe 2.08: Domain d3lmjl1: 3lmj L:1-112

Lineage for d3lmjl1 (3lmj L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3lmjl1: 3lmj L:1-112 [212936]
   Other proteins in same PDB: d3lmjl2
   automated match to d1aqkl1
   complexed with mpd

Details for d3lmjl1

PDB Entry: 3lmj, 2.2 Å

PDB Description: Structure of human anti HIV 21c Fab

PDB Compounds: (L:) Light chain of anti HIV Fab from human 21c antibody

SCOPe Domain Sequences for d3lmjl1:

Sequence; same for both SEQRES and ATOM records:

>d3lmjl1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgsssnigknyvswyqqlpgaapkllifddtqrpsgip
drfsgsksgtsatlaitglqtgdeadyycgtwdsslstgqlfgggtkltvlg

Timeline for d3lmjl1:

• d3lmjl1 first appeared in SCOPe 2.03
  
• d3lmjl1 appears in SCOPe 2.07