Lineage for d3llpa2 (3llp A:141-259)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1317037Superfamily b.42.5: Actin-crosslinking proteins [50405] (2 families) (S)
  5. 1317038Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 1317039Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 1317040Species Human (Homo sapiens) [TaxId:9606] [50408] (2 PDB entries)
  8. 1317042Domain d3llpa2: 3llp A:141-259 [212927]
    automated match to d1dfca2
    complexed with br, epe, gol, k, so4

Details for d3llpa2

PDB Entry: 3llp (more details), 1.8 Å

PDB Description: 1.8 Angstrom human fascin 1 crystal structure
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d3llpa2:

Sequence, based on SEQRES records: (download)

>d3llpa2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

Sequence, based on observed residues (ATOM records): (download)

>d3llpa2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsaadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdgrl
varpepatgytlefrkvafrdcegrylapsgpsgtlkagkvgkdelfaleqs

SCOPe Domain Coordinates for d3llpa2:

Click to download the PDB-style file with coordinates for d3llpa2.
(The format of our PDB-style files is described here.)

Timeline for d3llpa2: