| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries) |
| Domain d3ljfd1: 3ljf D:1-82 [212923] Other proteins in same PDB: d3ljfa2, d3ljfb2, d3ljfc2, d3ljfd2 automated match to d1isca1 complexed with fe |
PDB Entry: 3ljf (more details), 2.1 Å
SCOPe Domain Sequences for d3ljfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ljfd1 a.2.11.0 (D:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp
Timeline for d3ljfd1: