Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Pseudoalteromonas haloplanktis [TaxId:326442] [225960] (4 PDB entries) |
Domain d3ljfb2: 3ljf B:83-192 [212920] Other proteins in same PDB: d3ljfa1, d3ljfb1, d3ljfc1, d3ljfd1 automated match to d2nyba2 complexed with fe, tre |
PDB Entry: 3ljf (more details), 2.1 Å
SCOPe Domain Sequences for d3ljfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ljfb2 d.44.1.0 (B:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]} ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d3ljfb2: