Lineage for d15c8l2 (15c8 L:108-212)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550033Domain d15c8l2: 15c8 L:108-212 [21292]
    Other proteins in same PDB: d15c8h1, d15c8h2, d15c8l1
    part of catalytic Fab 5C8

Details for d15c8l2

PDB Entry: 15c8 (more details), 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

SCOP Domain Sequences for d15c8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d15c8l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d15c8l2:

Click to download the PDB-style file with coordinates for d15c8l2.
(The format of our PDB-style files is described here.)

Timeline for d15c8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d15c8l1