![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
![]() | Domain d15c8l2: 15c8 L:108-212 [21292] Other proteins in same PDB: d15c8h1, d15c8h2, d15c8l1 part of catalytic Fab 5C8 |
PDB Entry: 15c8 (more details), 2.5 Å
SCOP Domain Sequences for d15c8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d15c8l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d15c8l2: