SCOP 1.55: Domain d15c8l2: 15c8 L:108-212

Lineage for d15c8l2 (15c8 L:108-212)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Catalytic Fab 5C8 (mouse), kappa L chain [49073] (3 PDB entries)

8. Domain d15c8l2: 15c8 L:108-212 [21292]
   Other proteins in same PDB: d15c8h1, d15c8l1

Details for d15c8l2

PDB Entry: 15c8, 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

SCOP Domain Sequences for d15c8l2:

Sequence; same for both SEQRES and ATOM records:

>d15c8l2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d15c8l2:

• d15c8l2 appears in SCOP 1.57
  
• d15c8l2 appears in the current release, SCOPe 2.08