Lineage for d3ljfb1 (3ljf B:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690543Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)
  8. 2690551Domain d3ljfb1: 3ljf B:1-82 [212919]
    Other proteins in same PDB: d3ljfa2, d3ljfb2, d3ljfc2, d3ljfd2
    automated match to d1isca1
    complexed with fe

Details for d3ljfb1

PDB Entry: 3ljf (more details), 2.1 Å

PDB Description: the x-ray structure of iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form ii)
PDB Compounds: (B:) iron superoxide dismutase

SCOPe Domain Sequences for d3ljfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljfb1 a.2.11.0 (B:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

SCOPe Domain Coordinates for d3ljfb1:

Click to download the PDB-style file with coordinates for d3ljfb1.
(The format of our PDB-style files is described here.)

Timeline for d3ljfb1: