Lineage for d3lj9a1 (3lj9 A:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690543Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)
  8. 2690554Domain d3lj9a1: 3lj9 A:1-82 [212913]
    Other proteins in same PDB: d3lj9a2, d3lj9b2
    automated match to d1isca1
    complexed with azi, fe

Details for d3lj9a1

PDB Entry: 3lj9 (more details), 2.1 Å

PDB Description: x-ray structure of the iron superoxide dismutase from pseudoalteromonas haloplanktis in complex with sodium azide
PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d3lj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lj9a1 a.2.11.0 (A:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

SCOPe Domain Coordinates for d3lj9a1:

Click to download the PDB-style file with coordinates for d3lj9a1.
(The format of our PDB-style files is described here.)

Timeline for d3lj9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lj9a2