![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily) possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) ![]() automatically mapped to Pfam PF01425 |
![]() | Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins) |
![]() | Protein automated matches [191046] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188885] (20 PDB entries) |
![]() | Domain d3lj7b_: 3lj7 B: [212912] automated match to d2wapb_ complexed with cl, oho |
PDB Entry: 3lj7 (more details), 2.3 Å
SCOPe Domain Sequences for d3lj7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lj7b_ c.117.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tgrqkargaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgel speavfftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghd stlglslnegmpsesdcvvvqvlklqgavpfvhtnvpqsmfsydcsnplfgqtmnpwkss kspggssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvy gqtavqlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyye tdnytmpspamrralietkqrleaaghtlipflpnnipyalevlstgglfsdggrsflqn fkgdfvdpclgdlililrlpswfkrllslllkplfprlaaflnnmrprsaeklwklqhei emyrqsviaqwkamnldvlltpmlgpaldlntpgratgavsytmlyncldfpagvvpvtt vtaeddaqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveql mtpqkqp
Timeline for d3lj7b_: