SCOPe 2.08: Domain d3lj3a3: 3lj3 A:545-725

Lineage for d3lj3a3 (3lj3 A:545-725)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)

8. Domain d3lj3a3: 3lj3 A:545-725 [212907]
   Other proteins in same PDB: d3lj3a1, d3lj3a2, d3lj3a4, d3lj3a5
   automated match to d1e8ya1
   complexed with so4, wye

Details for d3lj3a3

PDB Entry: 3lj3, 2.43 Å

PDB Description: PI3-kinase-gamma with a pyrrolopyridine-benzofuran inhibitor

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3lj3a3:

Sequence; same for both SEQRES and ATOM records:

>d3lj3a3 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
g

Timeline for d3lj3a3:

• d3lj3a3 first appeared in SCOPe 2.03
  
• d3lj3a3 appears in SCOPe 2.07