Lineage for d25c8l2 (25c8 L:108-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159468Species Catalytic Fab 5C8 (mouse), kappa L chain [49073] (3 PDB entries)
  8. 159472Domain d25c8l2: 25c8 L:108-211 [21290]
    Other proteins in same PDB: d25c8h1, d25c8l1

Details for d25c8l2

PDB Entry: 25c8 (more details), 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d25c8l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d25c8l2:

Click to download the PDB-style file with coordinates for d25c8l2.
(The format of our PDB-style files is described here.)

Timeline for d25c8l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d25c8l1