Lineage for d3li6g_ (3li6 G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997383Protein automated matches [190064] (21 species)
    not a true protein
  7. 1997410Species Entamoeba histolytica [TaxId:294381] [225835] (3 PDB entries)
  8. 1997413Domain d3li6g_: 3li6 G: [212899]
    automated match to d2nxqa_
    complexed with ca

Details for d3li6g_

PDB Entry: 3li6 (more details), 2.5 Å

PDB Description: Crystal structure and trimer-monomer transition of N-terminal domain of EhCaBP1 from Entamoeba histolytica
PDB Compounds: (G:) calcium-binding protein

SCOPe Domain Sequences for d3li6g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li6g_ a.39.1.5 (G:) automated matches {Entamoeba histolytica [TaxId: 294381]}
aealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefakf
ygsi

SCOPe Domain Coordinates for d3li6g_:

Click to download the PDB-style file with coordinates for d3li6g_.
(The format of our PDB-style files is described here.)

Timeline for d3li6g_: