Lineage for d3lhpm_ (3lhp M:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033509Domain d3lhpm_: 3lhp M: [212893]
    Other proteins in same PDB: d3lhph2
    automated match to d1mqkh_
    complexed with edo

Details for d3lhpm_

PDB Entry: 3lhp (more details), 2.7 Å

PDB Description: crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
PDB Compounds: (M:) Fv 4E10 light chain

SCOPe Domain Sequences for d3lhpm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhpm_ b.1.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklv

SCOPe Domain Coordinates for d3lhpm_:

Click to download the PDB-style file with coordinates for d3lhpm_.
(The format of our PDB-style files is described here.)

Timeline for d3lhpm_: