SCOPe 2.08: Domain d3lhpl1: 3lhp L:1-107

Lineage for d3lhpl1 (3lhp L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3lhpl1: 3lhp L:1-107 [212892]
   Other proteins in same PDB: d3lhph2, d3lhpl2, d3lhpm2
   automated match to d1mqkh_
   complexed with edo

Details for d3lhpl1

PDB Entry: 3lhp, 2.7 Å

PDB Description: crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex

PDB Compounds: (L:) Fv 4E10 light chain

SCOPe Domain Sequences for d3lhpl1:

Sequence; same for both SEQRES and ATOM records:

>d3lhpl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d3lhpl1:

• d3lhpl1 first appeared in SCOPe 2.03, called d3lhpl_
  
• d3lhpl1 was called d3lhpl_ in SCOPe 2.07