SCOPe 2.06: Domain d3lhpi_: 3lhp I:

Lineage for d3lhpi_ (3lhp I:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3lhpi_: 3lhp I: [212891]
   Other proteins in same PDB: d3lhph2
   automated match to d3ebaa_
   complexed with edo

Details for d3lhpi_

PDB Entry: 3lhp, 2.7 Å

PDB Description: crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex

PDB Compounds: (I:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3lhpi_:

Sequence, based on SEQRES records:

>d3lhpi_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvs

Sequence, based on observed residues (ATOM records):

>d3lhpi_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttglgkpigafahwgqgtlvt
vs

Timeline for d3lhpi_:

• d3lhpi_ first appeared in SCOPe 2.03
  
• d3lhpi_ appears in SCOPe 2.05
  
• d3lhpi_ appears in SCOPe 2.07
  
• d3lhpi_ appears in the current release, SCOPe 2.08