Lineage for d3lhpi_ (3lhp I:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2027818Domain d3lhpi_: 3lhp I: [212891]
    Other proteins in same PDB: d3lhph2
    automated match to d3ebaa_
    complexed with edo

Details for d3lhpi_

PDB Entry: 3lhp (more details), 2.7 Å

PDB Description: crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex
PDB Compounds: (I:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3lhpi_:

Sequence, based on SEQRES records: (download)

>d3lhpi_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvs

Sequence, based on observed residues (ATOM records): (download)

>d3lhpi_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttglgkpigafahwgqgtlvt
vs

SCOPe Domain Coordinates for d3lhpi_:

Click to download the PDB-style file with coordinates for d3lhpi_.
(The format of our PDB-style files is described here.)

Timeline for d3lhpi_: