Lineage for d3lhla_ (3lhl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874326Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2874327Protein automated matches [190626] (14 species)
    not a true protein
  7. 2874376Species Clostridium difficile [TaxId:272563] [225843] (1 PDB entry)
  8. 2874377Domain d3lhla_: 3lhl A: [212889]
    automated match to d2ceva_
    complexed with mn, mpd, po4

Details for d3lhla_

PDB Entry: 3lhl (more details), 2.3 Å

PDB Description: crystal structure of a putative agmatinase from clostridium difficile
PDB Compounds: (A:) Putative agmatinase

SCOPe Domain Sequences for d3lhla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhla_ c.42.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
nyeesnlivfgvgfdgttsnrpgarfasssmrkefygletyspfldldledynicdygdl
eisvgsteqvlkeiyqetykivrdskvpfmiggehlvtlpafkavhekyndiyvihfdah
tdlreeynnsknshatvikriwdivgdnkifqfgirsgtkeefkfateekhtymeiggid
tfenivnmlngkniyltidldvldasvfpgtgtpepggvnyrefqeifkiiknsninivg
cdivelspdydttgvstviackilrelcliisdkik

SCOPe Domain Coordinates for d3lhla_:

Click to download the PDB-style file with coordinates for d3lhla_.
(The format of our PDB-style files is described here.)

Timeline for d3lhla_: