Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (14 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [225843] (1 PDB entry) |
Domain d3lhla_: 3lhl A: [212889] automated match to d2ceva_ complexed with mn, mpd, po4 |
PDB Entry: 3lhl (more details), 2.3 Å
SCOPe Domain Sequences for d3lhla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhla_ c.42.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} nyeesnlivfgvgfdgttsnrpgarfasssmrkefygletyspfldldledynicdygdl eisvgsteqvlkeiyqetykivrdskvpfmiggehlvtlpafkavhekyndiyvihfdah tdlreeynnsknshatvikriwdivgdnkifqfgirsgtkeefkfateekhtymeiggid tfenivnmlngkniyltidldvldasvfpgtgtpepggvnyrefqeifkiiknsninivg cdivelspdydttgvstviackilrelcliisdkik
Timeline for d3lhla_: