Lineage for d3lhdd_ (3lhd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894995Species Pyrococcus abyssi [TaxId:272844] [225897] (2 PDB entries)
  8. 2895003Domain d3lhdd_: 3lhd D: [212888]
    automated match to d2yvla_
    protein/RNA complex; complexed with sah

Details for d3lhdd_

PDB Entry: 3lhd (more details), 2.59 Å

PDB Description: Crystal structure of P. abyssi tRNA m1A58 methyltransferase in complex with S-adenosyl-L-homocysteine
PDB Compounds: (D:) SAM-dependent methyltransferase, putative

SCOPe Domain Sequences for d3lhdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhdd_ c.66.1.0 (D:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilr
privdyldkmkrgpqivhpkdaalivayagispgdfiveagvgsgaltlflanivgpegr
vvsyeiredfaklawenikwagfddrvtiklkdiyegieeenvdhvildlpqpervveha
akalkpggffvaytpcsnqvmrlheklrefkdyfmkprtinvlvfdqevkkecmrprtta
lvhtgyitfarri

SCOPe Domain Coordinates for d3lhdd_:

Click to download the PDB-style file with coordinates for d3lhdd_.
(The format of our PDB-style files is described here.)

Timeline for d3lhdd_: