Lineage for d3lh2o_ (3lh2 O:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367332Domain d3lh2o_: 3lh2 O: [212884]
    Other proteins in same PDB: d3lh2h2, d3lh2i2, d3lh2k2
    automated match to d1mqkh_

Details for d3lh2o_

PDB Entry: 3lh2 (more details), 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex
PDB Compounds: (O:) Fv 4E10 light chain

SCOPe Domain Sequences for d3lh2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lh2o_ b.1.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgv
adrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl

SCOPe Domain Coordinates for d3lh2o_:

Click to download the PDB-style file with coordinates for d3lh2o_.
(The format of our PDB-style files is described here.)

Timeline for d3lh2o_: