SCOPe 2.03: Domain d3lh2o_: 3lh2 O:

Lineage for d3lh2o_ (3lh2 O:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3lh2o_: 3lh2 O: [212884]
   automated match to d1mqkh_

Details for d3lh2o_

PDB Entry: 3lh2, 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex

PDB Compounds: (O:) Fv 4E10 light chain

SCOPe Domain Sequences for d3lh2o_:

Sequence; same for both SEQRES and ATOM records:

>d3lh2o_ b.1.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgv
adrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl

Timeline for d3lh2o_:

• d3lh2o_ is new in SCOPe 2.03-stable
  
• d3lh2o_ appears in SCOPe 2.04
  
• d3lh2o_ appears in the current release, SCOPe 2.08, called d3lh2o1