Lineage for d3lh2m1 (3lh2 M:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756555Domain d3lh2m1: 3lh2 M:1-107 [212882]
    Other proteins in same PDB: d3lh2h2, d3lh2i2, d3lh2k2, d3lh2l2, d3lh2m2, d3lh2n2, d3lh2o2
    automated match to d1mqkh_

Details for d3lh2m1

PDB Entry: 3lh2 (more details), 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex
PDB Compounds: (M:) Fv 4E10 light chain

SCOPe Domain Sequences for d3lh2m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lh2m1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d3lh2m1:

Click to download the PDB-style file with coordinates for d3lh2m1.
(The format of our PDB-style files is described here.)

Timeline for d3lh2m1: