Lineage for d3lh2h_ (3lh2 H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519949Domain d3lh2h_: 3lh2 H: [212877]
    automated match to d3ebaa_

Details for d3lh2h_

PDB Entry: 3lh2 (more details), 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex
PDB Compounds: (H:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3lh2h_:

Sequence, based on SEQRES records: (download)

>d3lh2h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvsslehhh

Sequence, based on observed residues (ATOM records): (download)

>d3lh2h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttlgkpigafahwgqgtlvtv
sslehhh

SCOPe Domain Coordinates for d3lh2h_:

Click to download the PDB-style file with coordinates for d3lh2h_.
(The format of our PDB-style files is described here.)

Timeline for d3lh2h_: