SCOPe 2.08: Domain d3lh2h1: 3lh2 H:2-126

Lineage for d3lh2h1 (3lh2 H:2-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3lh2h1: 3lh2 H:2-126 [212877]
   Other proteins in same PDB: d3lh2h2, d3lh2i2, d3lh2k2, d3lh2l2, d3lh2m2, d3lh2n2, d3lh2o2
   automated match to d3ebaa_

Details for d3lh2h1

PDB Entry: 3lh2, 2.65 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1VI7A_S0_002_N 4E10 Fv complex

PDB Compounds: (H:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3lh2h1:

Sequence, based on SEQRES records:

>d3lh2h1 b.1.1.0 (H:2-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqgt
lvtvs

Sequence, based on observed residues (ATOM records):

>d3lh2h1 b.1.1.0 (H:2-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitnya
prfqgrititadrststaylelnslrpedtavyycaregttlgkpigafahwgqgtlvtv
s

Timeline for d3lh2h1:

• d3lh2h1 first appeared in SCOPe 2.03, called d3lh2h_
  
• d3lh2h1 appears in SCOPe 2.07