SCOPe 2.07: Domain d3lgab_: 3lga B:

Lineage for d3lgab_ (3lga B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:272844] [225897] (2 PDB entries)

8. Domain d3lgab_: 3lga B: [212871]
   automated match to d2yvla_
   protein/RNA complex; complexed with sah, so4

Details for d3lgab_

PDB Entry: 3lga, 2.05 Å

PDB Description: Crystal structure of P. abyssi tRNA m1A58 methyltransferase in complex with S-adenosyl-L-homocysteine

PDB Compounds: (B:) SAM-dependent methyltransferase

SCOPe Domain Sequences for d3lgab_:

Sequence; same for both SEQRES and ATOM records:

>d3lgab_ c.66.1.0 (B:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilr
privdyldkmkrgpqivhpkdaalivayagispgdfiveagvgsgaltlflanivgpegr
vvsyeiredfaklawenikwagfddrvtiklkdiyegieeenvdhvildlpqpervveha
akalkpggffvaytpcsnqvmrlheklrefkdyfmkprtinvlvfdqevkkecmrprtta
lvhtgyitfarri

Timeline for d3lgab_:

• d3lgab_ first appeared in SCOPe 2.03
  
• d3lgab_ appears in SCOPe 2.06
  
• d3lgab_ appears in the current release, SCOPe 2.08