![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain [49072] (1 PDB entry) |
![]() | Domain d1eo8h2: 1eo8 H:114-212 [21287] Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h1, d1eo8l1 complexed with man, nag |
PDB Entry: 1eo8 (more details), 2.8 Å
SCOP Domain Sequences for d1eo8h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo8h2 b.1.1.2 (H:114-212) Immunoglobulin (constant domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
Timeline for d1eo8h2:
![]() Domains from other chains: (mouse over for more information) d1eo8a_, d1eo8b_, d1eo8l1, d1eo8l2 |