Lineage for d3lfua1 (3lfu A:3-315)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114119Species Escherichia coli [TaxId:562] [226067] (4 PDB entries)
  8. 2114120Domain d3lfua1: 3lfu A:3-315 [212868]
    automated match to d1pjra1
    complexed with so4

Details for d3lfua1

PDB Entry: 3lfu (more details), 1.8 Å

PDB Description: crystal structure of e. coli uvrd
PDB Compounds: (A:) DNA helicase II

SCOPe Domain Sequences for d3lfua1:

Sequence, based on SEQRES records: (download)

>d3lfua1 c.37.1.0 (A:3-315) automated matches {Escherichia coli [TaxId: 562]}
vsylldslndkqreavaaprsnllvlagagsgktrvlvhriawlmsvencspysimavtf
tnkaaaemrhrigqlmgtsqggmwvgtfhglahrllrahhmdanlpqdfqildsedqlrl
lkrlikamnldekqwpprqamwyinsqkdeglrphhiqsygnpveqtwqkvyqayqeacd
raglvdfaelllrahelwlnkphilqhyrerftnilvdefqdtnniqyawirllagdtgk
vmivgdddqsiygwrgaqveniqrflndfpgaetirleqnyrstsnilsaanaliennng
rlgkklwtdgadg

Sequence, based on observed residues (ATOM records): (download)

>d3lfua1 c.37.1.0 (A:3-315) automated matches {Escherichia coli [TaxId: 562]}
vsylldslndkqreavaaprsnllvlagagsgktrvlvhriawlmsvencspysimavtf
tnkaaaemrhrigqlmgtsqggmwvgtfhglahrllrahhmdanlpqdfqildsedqlrl
lkrlikamnldekqwpprqamwyinsqkdeglrphhinpveqtwqkvyqayqeacdragl
vdfaelllrahelwlnkphilqhyrerftnilvdefqdtnniqyawirllagdtgkvmiv
gdddqsiygwrgaqveniqrflndfpgaetirleqnyrstsnilsaanaliennngrlgk
klwtdgadg

SCOPe Domain Coordinates for d3lfua1:

Click to download the PDB-style file with coordinates for d3lfua1.
(The format of our PDB-style files is described here.)

Timeline for d3lfua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lfua2