| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
| Domain d1eo8l2: 1eo8 L:107-211 [21286] Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h1, d1eo8h2, d1eo8l1 part of Influenza virus hemagglutinin-neutralizing Fab BH151 complexed with man, nag |
PDB Entry: 1eo8 (more details), 2.8 Å
SCOP Domain Sequences for d1eo8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo8l2 b.1.1.2 (L:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1eo8l2:
View in 3DDomains from other chains: (mouse over for more information) d1eo8a_, d1eo8b_, d1eo8h1, d1eo8h2 |