Lineage for d1eo8l2 (1eo8 L:107-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9199Species Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain [49072] (1 PDB entry)
  8. 9201Domain d1eo8l2: 1eo8 L:107-211 [21286]
    Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h1, d1eo8l1

Details for d1eo8l2

PDB Entry: 1eo8 (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo8l2 b.1.1.2 (L:107-211) Immunoglobulin (constant domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain}
radaaptvsifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1eo8l2:

Click to download the PDB-style file with coordinates for d1eo8l2.
(The format of our PDB-style files is described here.)

Timeline for d1eo8l2: