SCOPe 2.08: Domain d3levh1: 3lev H:1-113

Lineage for d3levh1 (3lev H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d3levh1: 3lev H:1-113 [212858]
   Other proteins in same PDB: d3levh2, d3levl1, d3levl2
   automated match to d1tjgh1
   complexed with 1pe, atp, gol

Details for d3levh1

PDB Entry: 3lev, 2.5 Å

PDB Description: hiv-1 antibody 2f5 in complex with epitope scaffold es2

PDB Compounds: (H:) 2f5 antibody heavy chain

SCOPe Domain Sequences for d3levh1:

Sequence; same for both SEQRES and ATOM records:

>d3levh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d3levh1:

• d3levh1 first appeared in SCOPe 2.03
  
• d3levh1 appears in SCOPe 2.07