Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (45 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [226059] (1 PDB entry) |
Domain d3leha2: 3leh A:168-388 [212857] automated match to d1xpma2 complexed with no3 |
PDB Entry: 3leh (more details), 1.7 Å
SCOPe Domain Sequences for d3leha2:
Sequence, based on SEQRES records: (download)
>d3leha2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 210007]} ililhdetlaqtrdimdfwrpnytttpyvngmystkqyldmlkttwaeyqkrfdvsltdf aafcfhlpfpklalkgfnkimdkqvpsdlqeklkvnfeasilyskqigniytgslflgll sllensqnlvagdkialfsygsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsveny ekiffeeaqlddkgnasfkeyqtgpfalkeilehqriygkv
>d3leha2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 210007]} ililhdetlaqtrdistkqyldmlkttwaeyqkrfdvsltdfaafcfhlpfpklalkgfn kidkqpsdlqeklkvnfeasilyskqigniytgslflgllsllensqnlvagdkialfsy gsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsvenyekiffeeaqasfkeyqtgpf alkeilehqriygkv
Timeline for d3leha2: