SCOPe 2.08: Domain d3ldvb_: 3ldv B:

Lineage for d3ldvb_ (3ldv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [225822] (1 PDB entry)

8. Domain d3ldvb_: 3ldv B: [212855]
   Other proteins in same PDB: d3ldva2
   automated match to d1l2ua_
   complexed with cl, mg

Details for d3ldvb_

PDB Entry: 3ldv, 1.77 Å

PDB Description: 1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3ldvb_:

Sequence, based on SEQRES records:

>d3ldvb_ c.1.2.3 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
pagseqgdqrrimtpaqaiasgsdylvigrpitqaahpevvleeinsslv

Sequence, based on observed residues (ATOM records):

>d3ldvb_ c.1.2.3 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
paqrrimtpaqaiasgsdylvigrpitqaahpevvleeinsslv

Timeline for d3ldvb_:

• d3ldvb_ first appeared in SCOPe 2.03
  
• d3ldvb_ appears in SCOPe 2.07