SCOPe 2.03: Domain d3ldob1: 3ldo B:26-214

Lineage for d3ldob1 (3ldo B:26-214)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries)

8. Domain d3ldob1: 3ldo B:26-214 [212848]
   automated match to d2qw9a1
   complexed with anp

Details for d3ldob1

PDB Entry: 3ldo, 1.95 Å

PDB Description: Crystal structure of human GRP78 (70kDa heat shock protein 5 / BIP) ATPase domain in complex with AMPPNP

PDB Compounds: (B:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d3ldob1:

Sequence; same for both SEQRES and ATOM records:

>d3ldob1 c.55.1.0 (B:26-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
aiaygldkr

Timeline for d3ldob1:

• d3ldob1 is new in SCOPe 2.03-stable
  
• d3ldob1 appears in SCOPe 2.04
  
• d3ldob1 appears in the current release, SCOPe 2.08