Lineage for d3ldfa2 (3ldf A:69-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130452Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 protein domains)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam PF05958)
  6. 2130457Protein Hypothetical protein SMu776, middle and C-terminal domains [142640] (1 species)
  7. 2130458Species Streptococcus mutans [TaxId:1309] [142641] (2 PDB entries)
    Uniprot Q8DUW5 69-385
  8. 2130460Domain d3ldfa2: 3ldf A:69-385 [212837]
    Other proteins in same PDB: d3ldfa1
    automated match to d2b78a2
    complexed with sah

Details for d3ldfa2

PDB Entry: 3ldf (more details), 2.23 Å

PDB Description: Crystal structure of SMU.776, a putative methyltransferase complexed with SAH
PDB Compounds: (A:) Putative uncharacterized protein SMU.776

SCOPe Domain Sequences for d3ldfa2:

Sequence, based on SEQRES records: (download)

>d3ldfa2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}
lnvtyfiklfqwskdkrknfahsklttayrlfnqdgdsfggvtidcygdfvlfswynsfv
yqirdeivaafrqvypnflgayekirfkgidnvsahlygqeapeqflilengisynvfln
dglmtgifldqrqvrnelingsaagktvlnlfsytaafsvaaamggamattsvdlakrsr
alslahfeanhldmanhqlvvmdvfdyfkyarrhhltydiiiidppsfarnkkevfsvsk
dyhklirqgleilsengliiastnaanmtvsqfkkqiekgfgkqkhtyldlqqlpsdfav
nvqdessnylkvftikv

Sequence, based on observed residues (ATOM records): (download)

>d3ldfa2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}
lnvtyfiklfqwskdkrknfahsklttayrlfnqdgdsfggvtidcygdfvlfswynsfv
yqirdeivaafrqvypnflgayekirfnvsahlygqeapeqflilengisynvflndglm
tgifldqrqvrnelingsaagktvlnlfsytaafsvaaamggamattsvdlakrsralsl
ahfeanhldmanhqlvvmdvfdyfkyarrhhltydiiiidppsfarnkevfsvskdyhkl
irqgleilsengliiastnaanmtvsqfkkqiekgfgkqkhtyldlqqlpsdfavnvqde
ssnylkvftikv

SCOPe Domain Coordinates for d3ldfa2:

Click to download the PDB-style file with coordinates for d3ldfa2.
(The format of our PDB-style files is described here.)

Timeline for d3ldfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ldfa1