![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins) N-terminal part of Pfam PF03602, structurally similar to PUA domain family |
![]() | Protein Hypothetical protein SMu776, N-terminal domain [141719] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [141720] (2 PDB entries) Uniprot Q8DUW5 1-68 |
![]() | Domain d3ldfa1: 3ldf A:1-68 [212836] Other proteins in same PDB: d3ldfa2 automated match to d2b78a1 complexed with sah |
PDB Entry: 3ldf (more details), 2.23 Å
SCOPe Domain Sequences for d3ldfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldfa1 b.122.1.9 (A:1-68) Hypothetical protein SMu776, N-terminal domain {Streptococcus mutans [TaxId: 1309]} miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw lispkkvs
Timeline for d3ldfa1: