SCOPe 2.03: Domain d3ldfa1: 3ldf A:1-68

Lineage for d3ldfa1 (3ldf A:1-68)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein SMu776, N-terminal domain [141719] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [141720] (2 PDB entries)
   Uniprot Q8DUW5 1-68

8. Domain d3ldfa1: 3ldf A:1-68 [212836]
   Other proteins in same PDB: d3ldfa2
   automated match to d2b78a1
   complexed with sah

Details for d3ldfa1

PDB Entry: 3ldf, 2.23 Å

PDB Description: Crystal structure of SMU.776, a putative methyltransferase complexed with SAH

PDB Compounds: (A:) Putative uncharacterized protein SMU.776

SCOPe Domain Sequences for d3ldfa1:

Sequence; same for both SEQRES and ATOM records:

>d3ldfa1 b.122.1.9 (A:1-68) Hypothetical protein SMu776, N-terminal domain {Streptococcus mutans [TaxId: 1309]}
miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw
lispkkvs

Timeline for d3ldfa1:

• d3ldfa1 is new in SCOPe 2.03-stable
  
• d3ldfa1 appears in SCOPe 2.04
  
• d3ldfa1 appears in the current release, SCOPe 2.08