SCOPe 2.04: Domain d3ldbb2: 3ldb B:114-217

Lineage for d3ldbb2 (3ldb B:114-217)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Cricetulus migratorius [TaxId:10032] [225940] (5 PDB entries)

8. Domain d3ldbb2: 3ldb B:114-217 [212835]
   automated match to d1c5da2
   complexed with akg, fe, gol, hg, so4

Details for d3ldbb2

PDB Entry: 3ldb, 2.7 Å

PDB Description: structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3ldbb2:

Sequence; same for both SEQRES and ATOM records:

>d3ldbb2 b.1.1.0 (B:114-217) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnr

Timeline for d3ldbb2:

• d3ldbb2 first appeared in SCOPe 2.03
  
• d3ldbb2 appears in SCOPe 2.05
  
• d3ldbb2 appears in the current release, SCOPe 2.08