| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries) |
| Domain d3ldbb2: 3ldb B:114-217 [212835] automated match to d1c5da2 complexed with akg, fe, gol, hg, so4 |
PDB Entry: 3ldb (more details), 2.7 Å
SCOPe Domain Sequences for d3ldbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldbb2 b.1.1.0 (B:114-217) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnr
Timeline for d3ldbb2: