Lineage for d3ldbb2 (3ldb B:114-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754215Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)
  8. 2754228Domain d3ldbb2: 3ldb B:114-217 [212835]
    automated match to d1c5da2
    complexed with akg, fe, gol, hg, so4

Details for d3ldbb2

PDB Entry: 3ldb (more details), 2.7 Å

PDB Description: structure of jmjd6 complexd with alpha-ketoglutarate and fab fragment.
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3ldbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldbb2 b.1.1.0 (B:114-217) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnr

SCOPe Domain Coordinates for d3ldbb2:

Click to download the PDB-style file with coordinates for d3ldbb2.
(The format of our PDB-style files is described here.)

Timeline for d3ldbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ldbb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ldbc_