SCOPe 2.08: Domain d3ld8b2: 3ld8 B:114-217

Lineage for d3ld8b2 (3ld8 B:114-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)

8. Domain d3ld8b2: 3ld8 B:114-217 [212833]
   automated match to d1c5da2
   complexed with fe, gol, hg, so4

Details for d3ld8b2

PDB Entry: 3ld8, 2.7 Å

PDB Description: Structure of JMJD6 and Fab Fragments

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3ld8b2:

Sequence; same for both SEQRES and ATOM records:

>d3ld8b2 b.1.1.0 (B:114-217) automated matches {Cricetulus migratorius [TaxId: 10032]}
radakptvsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqd
skdstyslsstlsltkadyerhnlytcevthktstaaivktlnr

Timeline for d3ld8b2:

• d3ld8b2 first appeared in SCOPe 2.03
  
• d3ld8b2 appears in SCOPe 2.07