Lineage for d3ld8b1 (3ld8 B:1-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355317Species Cricetulus migratorius [TaxId:10032] [225940] (5 PDB entries)
  8. 2355326Domain d3ld8b1: 3ld8 B:1-113 [212832]
    automated match to d1c5da1
    complexed with fe, gol, hg, so4

Details for d3ld8b1

PDB Entry: 3ld8 (more details), 2.7 Å

PDB Description: Structure of JMJD6 and Fab Fragments
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3ld8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ld8b1 b.1.1.0 (B:1-113) automated matches {Cricetulus migratorius [TaxId: 10032]}
divmtqspsslavsagekvtmscrssqslyysgikknllawyqlkpgqspklliyyastl
ftgvpdrftgsgsgtdytltitsvqaedmgqyfcqqgisnpytfgagtkleik

SCOPe Domain Coordinates for d3ld8b1:

Click to download the PDB-style file with coordinates for d3ld8b1.
(The format of our PDB-style files is described here.)

Timeline for d3ld8b1: