Lineage for d3ld6a_ (3ld6 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278021Species Human (Homo sapiens) [TaxId:9606] [196470] (23 PDB entries)
  8. 1278103Domain d3ld6a_: 3ld6 A: [212830]
    automated match to d3jusb_
    complexed with bcd, hem, kkk

Details for d3ld6a_

PDB Entry: 3ld6 (more details), 2.8 Å

PDB Description: crystal structure of human lanosterol 14alpha-demethylase (cyp51) in complex with ketoconazole
PDB Compounds: (A:) Lanosterol 14-alpha demethylase

SCOPe Domain Sequences for d3ld6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ld6a_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vksppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
yfptvnyttmihtpenpvirykrrs

SCOPe Domain Coordinates for d3ld6a_:

Click to download the PDB-style file with coordinates for d3ld6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ld6a_: