| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (16 species) not a true protein |
| Species Aspergillus flavus [TaxId:5059] [226800] (5 PDB entries) |
| Domain d3ld4a2: 3ld4 A:137-295 [212829] automated match to d2yzca2 complexed with 8nx, edo, na |
PDB Entry: 3ld4 (more details), 1.35 Å
SCOPe Domain Sequences for d3ld4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ld4a2 d.96.1.0 (A:137-295) automated matches {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs
Timeline for d3ld4a2: