SCOPe 2.08: Domain d3ld4a2: 3ld4 A:137-295

Lineage for d3ld4a2 (3ld4 A:137-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (16 species)
   not a true protein

7. Species Aspergillus flavus [TaxId:5059] [226800] (5 PDB entries)

8. Domain d3ld4a2: 3ld4 A:137-295 [212829]
   automated match to d2yzca2
   complexed with 8nx, edo, na

Details for d3ld4a2

PDB Entry: 3ld4, 1.35 Å

PDB Description: urate oxidase complexed with 8-nitro xanthine

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d3ld4a2:

Sequence; same for both SEQRES and ATOM records:

>d3ld4a2 d.96.1.0 (A:137-295) automated matches {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

Timeline for d3ld4a2:

• d3ld4a2 first appeared in SCOPe 2.03
  
• d3ld4a2 appears in SCOPe 2.07