Lineage for d3ld3b_ (3ld3 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060813Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2060814Protein automated matches [190523] (11 species)
    not a true protein
  7. 2060815Species Anaplasma phagocytophilum [TaxId:212042] [225857] (1 PDB entry)
  8. 2060817Domain d3ld3b_: 3ld3 B: [212827]
    automated match to d2eipa_
    complexed with po4

Details for d3ld3b_

PDB Entry: 3ld3 (more details), 1.75 Å

PDB Description: crystal structure of inorganic phosphatase from anaplasma phagocytophilum at 1.75a resolution
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3ld3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ld3b_ b.40.5.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
digsgsnapeevnvvievsqdshpvkyefdekngalwvdrflptamyypcnygfipntia
gdgdpvdvlvlarfpvmpgavicvrpvgvlmmndekgedakvlavpatkvdqyygnivny
sdlpssfldsishffsfykklekdkfvsvgcwqdaasakelirsaiiaakk

SCOPe Domain Coordinates for d3ld3b_:

Click to download the PDB-style file with coordinates for d3ld3b_.
(The format of our PDB-style files is described here.)

Timeline for d3ld3b_: