Lineage for d3lcxa_ (3lcx A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822171Protein automated matches [190095] (20 species)
    not a true protein
  7. 1822180Species Escherichia coli K-12 [TaxId:83333] [225841] (10 PDB entries)
  8. 1822211Domain d3lcxa_: 3lcx A: [212822]
    automated match to d2wnqa_
    complexed with so4

Details for d3lcxa_

PDB Entry: 3lcx (more details), 1.98 Å

PDB Description: l-kdo aldolase
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d3lcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lcxa_ c.1.10.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslseraqvl
eivaeeakgkikliahvgcvstaesqqlaasakrhgfdavsavtpfyypfsleehcdhyr
aiidsadglpmvvynipalsgvkltlgqiytlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgifrglktvlhymdvisvplcrkpfgpvdekclpelkalaqqlmq

SCOPe Domain Coordinates for d3lcxa_:

Click to download the PDB-style file with coordinates for d3lcxa_.
(The format of our PDB-style files is described here.)

Timeline for d3lcxa_: